Lineage for d1omea_ (1ome A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949540Protein beta-Lactamase, class A [56606] (16 species)
  7. 1949724Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)
  8. 1949740Domain d1omea_: 1ome A: [42717]
    omega loop deletion mutant (residues 163-178 deleted)
    complexed with cl; mutant

Details for d1omea_

PDB Entry: 1ome (more details), 2.3 Å

PDB Description: crystal structure of the omega loop deletion mutant (residues 163-178 deleted) of beta-lactamase from staphylococcus aureus pc1
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1omea_:

Sequence, based on SEQRES records: (download)

>d1omea_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

Sequence, based on observed residues (ATOM records): (download)

>d1omea_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpdtstpaafgktlnkliangklskenkkflldlmlnnksgdtlikdgvpkdy
kvadksgqaityasrndvafvypkgqsepivlviftnkdnksdkpndklisetaksvmke
f

SCOPe Domain Coordinates for d1omea_:

Click to download the PDB-style file with coordinates for d1omea_.
(The format of our PDB-style files is described here.)

Timeline for d1omea_: