Lineage for d1blca_ (1blc A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. Protein beta-Lactamase, class A [56606] (16 species)
  7. Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)
  8. Domain d1blca_: 1blc A: [42714]
    complexed with cem, so4, tem

Details for d1blca_

PDB Entry: 1blc (more details), 2.2 Å

PDB Description: inhibition of beta-lactamase by clavulanate: trapped intermediates in cryocrystallographic studies
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1blca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blca_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

SCOPe Domain Coordinates for d1blca_ are not available.

Timeline for d1blca_: