Lineage for d1blh__ (1blh -)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517216Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 517217Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 517218Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)
  6. 517302Protein beta-Lactamase, class A [56606] (15 species)
  7. 517382Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)
  8. 517392Domain d1blh__: 1blh - [42713]

Details for d1blh__

PDB Entry: 1blh (more details), 2.3 Å

PDB Description: structure of a phosphonate-inhibited beta-lactamase. an analog of the tetrahedral transition state(slash)intermediate of beta-lactam hydrolysis

SCOP Domain Sequences for d1blh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blh__ e.3.1.1 (-) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

SCOP Domain Coordinates for d1blh__:

Click to download the PDB-style file with coordinates for d1blh__.
(The format of our PDB-style files is described here.)

Timeline for d1blh__: