Lineage for d1djc__ (1djc -)
- Root: SCOP 1.59
Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein beta-Lactamase, class A [56606] (12 species) 
Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries) 
Domain d1djc__: 1djc - [42710]
Details for d1djc__
PDB Entry: 1djc (more details), 2 Å
PDB Description: structure of beta-lactamase precursor, s70a mutant, at 120k
SCOP Domain Sequences for d1djc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djc__ e.3.1.1 (-) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayaatskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef
SCOP Domain Coordinates for d1djc__:
Click to download the PDB-style file with coordinates for d1djc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1djc__:
- d1djc__ first appeared (with stable ids) in SCOP 1.55
- d1djc__ appears in SCOP 1.57
- d1djc__ appears in SCOP 1.61
- d1djc__ appears in the current release, SCOPe 2.08, called d1djca_
View in 3D