Lineage for d1g6aa_ (1g6a A:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins) 
Protein beta-Lactamase, class A [56606] (11 species) 
Species Pseudomonas aeruginosa, PSE-4 carbenicillinase [TaxId:287] [56610] (2 PDB entries) 
Domain d1g6aa_: 1g6a A: [42704]
Details for d1g6aa_
PDB Entry: 1g6a (more details), 1.75 Å
PDB Description: pse-4 carbenicillinase, r234k mutant
SCOP Domain Sequences for d1g6aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6aa_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PSE-4 carbenicillinase}
skfqqveqdvkaievslsarigvsvldtqngeywdyngnqrfpltstfktiacakllyda
eqgkvnpnstveikkadlvtyspviekqvgqaitlddacfatmttsdntaaniilsavgg
pkgvtdflrqigdketrldriepdlnegklgdlrdtttpkaiastlnkflfgsalsemnq
kkleswmvnnqvtgnllrsvlpagwniadksgaggfgarsitavvwsehqapiivsiyla
qtqasmeerndaivkighsifdvyts
SCOP Domain Coordinates for d1g6aa_:
Click to download the PDB-style file with coordinates for d1g6aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g6aa_:
- d1g6aa_ appears in SCOP 1.57
- d1g6aa_ appears in the current release, SCOPe 2.08
View in 3D