Lineage for d1bzaa_ (1bza A:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742172Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 742173Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 742174Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)
  6. 742272Protein beta-Lactamase, class A [56606] (15 species)
  7. 742319Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (5 PDB entries)
  8. 742322Domain d1bzaa_: 1bza A: [42701]
    complexed with so4; mutant

Details for d1bzaa_

PDB Entry: 1bza (more details), 1.8 Å

PDB Description: beta-lactamase toho-1 from escherichia coli tuh12191
PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d1bzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzaa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaerrrdilaaaakivt

SCOP Domain Coordinates for d1bzaa_:

Click to download the PDB-style file with coordinates for d1bzaa_.
(The format of our PDB-style files is described here.)

Timeline for d1bzaa_: