Lineage for d1bza__ (1bza -)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517216Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 517217Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 517218Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)
  6. 517302Protein beta-Lactamase, class A [56606] (15 species)
  7. 517348Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (5 PDB entries)
  8. 517351Domain d1bza__: 1bza - [42701]

Details for d1bza__

PDB Entry: 1bza (more details), 1.8 Å

PDB Description: beta-lactamase toho-1 from escherichia coli tuh12191

SCOP Domain Sequences for d1bza__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bza__ e.3.1.1 (-) beta-Lactamase, class A {Escherichia coli, TOHO-1}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaerrrdilaaaakivt

SCOP Domain Coordinates for d1bza__:

Click to download the PDB-style file with coordinates for d1bza__.
(The format of our PDB-style files is described here.)

Timeline for d1bza__: