![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein beta-Lactamase, class A [56606] (16 species) |
![]() | Species Escherichia coli, TEM-1 [TaxId:562] [56607] (63 PDB entries) |
![]() | Domain d1eroa_: 1ero A: [42700] complexed with bjp |
PDB Entry: 1ero (more details), 2.1 Å
SCOPe Domain Sequences for d1eroa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eroa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]} hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg sqatmdernrqiaeigaslikhw
Timeline for d1eroa_: