Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) |
Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) |
Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) |
Protein beta-Lactamase, class A [56606] (12 species) |
Species Escherichia coli, TEM-1 [TaxId:562] [56607] (13 PDB entries) |
Domain d1fqga_: 1fqg A: [42699] |
PDB Entry: 1fqg (more details), 1.7 Å
SCOP Domain Sequences for d1fqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqga_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1} hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp keltaflhnmgdhvtrldrwnpelneaipnderdttmpaamattlrklltgelltlasrq qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg sqatmdernrqiaeigaslikhw
Timeline for d1fqga_: