Lineage for d1fqga_ (1fqg A:)
- Root: SCOP 1.59
Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein beta-Lactamase, class A [56606] (12 species) Species Escherichia coli, TEM-1 [TaxId:562] [56607] (13 PDB entries) 
Domain d1fqga_: 1fqg A: [42699]
Details for d1fqga_
PDB Entry: 1fqg (more details), 1.7 Å
PDB Description: molecular structure of the acyl-enzyme intermediate in tem-1 beta- lactamase
SCOP Domain Sequences for d1fqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqga_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwnpelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw
SCOP Domain Coordinates for d1fqga_:
Click to download the PDB-style file with coordinates for d1fqga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fqga_:
- d1fqga_ first appeared (with stable ids) in SCOP 1.55
- d1fqga_ appears in SCOP 1.57
- d1fqga_ appears in SCOP 1.61
- d1fqga_ appears in the current release, SCOPe 2.08
View in 3D