Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins) |
Protein beta-Lactamase, class A [56606] (15 species) |
Species Escherichia coli, TEM-1 [TaxId:562] [56607] (32 PDB entries) |
Domain d1esua_: 1esu A: [42696] complexed with so4; mutant |
PDB Entry: 1esu (more details), 2 Å
SCOP Domain Sequences for d1esua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esua_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]} hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq qlidwmeadkvagpllrsalpagwfiadkagagergsrgiiaalgpdgkpsrivviyttg sqatmdernrqiaeigaslikhw
Timeline for d1esua_: