Lineage for d1esua_ (1esu A:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883343Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)
  6. 883462Protein beta-Lactamase, class A [56606] (15 species)
  7. 883477Species Escherichia coli, TEM-1 [TaxId:562] [56607] (32 PDB entries)
  8. 883504Domain d1esua_: 1esu A: [42696]
    complexed with so4; mutant

Details for d1esua_

PDB Entry: 1esu (more details), 2 Å

PDB Description: s235a mutant of tem1 beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d1esua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esua_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadkagagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOP Domain Coordinates for d1esua_:

Click to download the PDB-style file with coordinates for d1esua_.
(The format of our PDB-style files is described here.)

Timeline for d1esua_: