SCOP 1.75: Domain d1xpba_: 1xpb A:

Lineage for d1xpba_ (1xpb A:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (32 PDB entries)

8. Domain d1xpba_: 1xpb A: [42694]
   complexed with so4

Details for d1xpba_

PDB Entry: 1xpb, 1.9 Å

PDB Description: structure of beta-lactamase tem1

PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d1xpba_:

Sequence; same for both SEQRES and ATOM records:

>d1xpba_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1xpba_:

• d1xpba_ first appeared (with stable ids) in SCOP 1.55, called d1xpb__
  
• d1xpba_ appears in SCOP 1.73
  
• d1xpba_ appears in SCOPe 2.01
  
• d1xpba_ appears in the current release, SCOPe 2.08