SCOP 1.69: Domain d1erma_: 1erm A:

Lineage for d1erma_ (1erm A:)

1. Root: SCOP 1.69

2. Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (28 PDB entries)

8. Domain d1erma_: 1erm A: [42690]

Details for d1erma_

PDB Entry: 1erm, 1.7 Å

PDB Description: x-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxyphenyl)ethane boronic acid

SCOP Domain Sequences for d1erma_:

Sequence; same for both SEQRES and ATOM records:

>d1erma_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1erma_:

• d1erma_ first appeared (with stable ids) in SCOP 1.55
  
• d1erma_ appears in SCOP 1.67
  
• d1erma_ appears in SCOP 1.71
  
• d1erma_ appears in the current release, SCOPe 2.08