SCOPe 2.04: Domain d1cega_: 1ceg A:

Lineage for d1cega_ (1ceg A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)

7. Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries)
   Uniprot P15555 34-378 ! Uniprot P15555

8. Domain d1cega_: 1ceg A: [42688]
   complexed with cep

Details for d1cega_

PDB Entry: 1ceg, 1.8 Å

PDB Description: cephalothin complexed with dd-peptidase

PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase transpeptidase

SCOPe Domain Sequences for d1cega_:

Sequence; same for both SEQRES and ATOM records:

>d1cega_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]}
adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

Timeline for d1cega_:

• d1cega_ first appeared (with stable ids) in SCOP 1.55, called d1ceg__
  
• d1cega_ appears in SCOPe 2.03
  
• d1cega_ appears in SCOPe 2.05
  
• d1cega_ appears in the current release, SCOPe 2.08