Lineage for d3ptea_ (3pte A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244798Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 2244807Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries)
    Uniprot P15555 34-378 ! Uniprot P15555
  8. 2244818Domain d3ptea_: 3pte A: [42687]

Details for d3ptea_

PDB Entry: 3pte (more details), 1.6 Å

PDB Description: the refined crystallographic structure of a dd-peptidase penicillin- target enzyme at 1.6 a resolution
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase transpeptidase

SCOPe Domain Sequences for d3ptea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ptea_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]}
adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

SCOPe Domain Coordinates for d3ptea_:

Click to download the PDB-style file with coordinates for d3ptea_.
(The format of our PDB-style files is described here.)

Timeline for d3ptea_: