SCOPe 2.08: Domain d3ptea_: 3pte A:

Lineage for d3ptea_ (3pte A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)

7. Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries)
   Uniprot P15555 34-378 ! Uniprot P15555

8. Domain d3ptea_: 3pte A: [42687]

Details for d3ptea_

PDB Entry: 3pte, 1.6 Å

PDB Description: the refined crystallographic structure of a dd-peptidase penicillin- target enzyme at 1.6 a resolution

PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase transpeptidase

SCOPe Domain Sequences for d3ptea_:

Sequence; same for both SEQRES and ATOM records:

>d3ptea_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]}
adlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrv
gsvtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmf
aqtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsva
teyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagav
isstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtg
tvqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

Timeline for d3ptea_:

• d3ptea_ first appeared (with stable ids) in SCOP 1.55, called d3pte__
  
• d3ptea_ appears in SCOPe 2.07