SCOPe 2.03: Domain d1hvba_: 1hvb A:

Lineage for d1hvba_ (1hvb A:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)

7. Species Streptomyces sp., R61 [TaxId:1931] [56605] (14 PDB entries)
   Uniprot P15555 34-378 ! Uniprot P15555

8. Domain d1hvba_: 1hvb A: [42686]
   complexed with ceh

Details for d1hvba_

PDB Entry: 1hvb, 1.17 Å

PDB Description: crystal structure of streptomyces r61 dd-peptidase complexed with a novel cephalosporin analog of cell wall peptidoglycan

PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d1hvba_:

Sequence; same for both SEQRES and ATOM records:

>d1hvba_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]}
dlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvg
svtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfa
qtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvat
eyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavi
sstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgt
vqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

Timeline for d1hvba_:

• d1hvba_ first appeared (with stable ids) in SCOP 1.55
  
• d1hvba_ appears in SCOPe 2.02
  
• d1hvba_ appears in SCOPe 2.04
  
• d1hvba_ appears in the current release, SCOPe 2.08