Lineage for d1hvba_ (1hvb A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86412Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 86413Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 86414Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 86540Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 86549Species Streptomyces sp., R61 [TaxId:1931] [56605] (4 PDB entries)
  8. 86550Domain d1hvba_: 1hvb A: [42686]

Details for d1hvba_

PDB Entry: 1hvb (more details), 1.17 Å

PDB Description: crystal structure of streptomyces r61 dd-peptidase complexed with a novel cephalosporin analog of cell wall peptidoglycan

SCOP Domain Sequences for d1hvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvba_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61}
dlpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvg
svtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfa
qtvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvat
eyqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavi
sstqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgt
vqgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp

SCOP Domain Coordinates for d1hvba_:

Click to download the PDB-style file with coordinates for d1hvba_.
(The format of our PDB-style files is described here.)

Timeline for d1hvba_: