Lineage for d1skf__ (1skf -)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37843Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 37844Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 37845Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 37927Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 37928Species Streptomyces sp., K15 [TaxId:1931] [56604] (7 PDB entries)
  8. 37934Domain d1skf__: 1skf - [42684]

Details for d1skf__

PDB Entry: 1skf (more details), 2 Å

PDB Description: crystal structure of the streptomyces k15 dd-transpeptidase

SCOP Domain Sequences for d1skf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skf__ e.3.1.1 (-) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15}
vtkptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiq
kaysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvks
figkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkayt
aktvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvl
astsiparesdatkimnygfal

SCOP Domain Coordinates for d1skf__:

Click to download the PDB-style file with coordinates for d1skf__.
(The format of our PDB-style files is described here.)

Timeline for d1skf__: