Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species) |
Species Streptomyces sp., K15 [TaxId:1931] [56604] (8 PDB entries) |
Domain d1skfa_: 1skf A: [42684] |
PDB Entry: 1skf (more details), 2 Å
SCOPe Domain Sequences for d1skfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skfa_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15 [TaxId: 1931]} vtkptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiq kaysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvks figkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkayt aktvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvl astsiparesdatkimnygfal
Timeline for d1skfa_: