Lineage for d1esia_ (1esi A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86412Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 86413Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 86414Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 86540Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 86541Species Streptomyces sp., K15 [TaxId:1931] [56604] (7 PDB entries)
  8. 86545Domain d1esia_: 1esi A: [42682]

Details for d1esia_

PDB Entry: 1esi (more details), 1.8 Å

PDB Description: r248l mutant of streptomyces k15 dd-transpeptidase

SCOP Domain Sequences for d1esia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esia_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15}
kptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiqka
ysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvksfi
gkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkaytak
tvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvlas
tsipalesdatkimnygfal

SCOP Domain Coordinates for d1esia_:

Click to download the PDB-style file with coordinates for d1esia_.
(The format of our PDB-style files is described here.)

Timeline for d1esia_: