Lineage for d1es2a_ (1es2 A:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37843Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 37844Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 37845Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 37927Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 37928Species Streptomyces sp., K15 [TaxId:1931] [56604] (7 PDB entries)
  8. 37930Domain d1es2a_: 1es2 A: [42680]

Details for d1es2a_

PDB Entry: 1es2 (more details), 1.55 Å

PDB Description: s96a mutant of streptomyces k15 dd-transpeptidase

SCOP Domain Sequences for d1es2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1es2a_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15}
kptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiqka
ysdyvvannasqahlivgdkvtvrqllyglmlpagcdaayaladkygsgstraarvksfi
gkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkaytak
tvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvlas
tsiparesdatkimnygfal

SCOP Domain Coordinates for d1es2a_:

Click to download the PDB-style file with coordinates for d1es2a_.
(The format of our PDB-style files is described here.)

Timeline for d1es2a_: