Lineage for d1es5a_ (1es5 A:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins) Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species) 
Species Streptomyces sp., K15 [TaxId:1931] [56604] (7 PDB entries) 
Domain d1es5a_: 1es5 A: [42679]
Details for d1es5a_
PDB Entry: 1es5 (more details), 1.4 Å
PDB Description: s216a mutant of streptomyces k15 dd-transpeptidase
SCOP Domain Sequences for d1es5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1es5a_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15}
kptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiqka
ysdyvvannasqahlivgdkvtvrqllyglmlpsgcdaayaladkygsgstraarvksfi
gkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkaytak
tvtktgsirtmdtwkntngllssysgaigvktgagpeakyclvfaatrggktvigtvlas
tsiparesdatkimnygfal
SCOP Domain Coordinates for d1es5a_:
Click to download the PDB-style file with coordinates for d1es5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1es5a_:
- d1es5a_ appears in SCOP 1.57
- d1es5a_ appears in the current release, SCOPe 2.08
View in 3D