Lineage for d1f0c.1 (1f0c A:,B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568346Protein Viral serpin crmA (cytokine response modifier protein) [56593] (1 species)
  7. 2568347Species Cowpox virus [TaxId:10243] [56594] (3 PDB entries)
  8. 2568349Domain d1f0c.1: 1f0c A:,B: [42676]
    cleaved form
    complexed with dtt

Details for d1f0c.1

PDB Entry: 1f0c (more details), 2.26 Å

PDB Description: structure of the viral serpin crma
PDB Compounds: (A:) ice inhibitor, (B:) ice inhibitor

SCOPe Domain Sequences for d1f0c.1:

Sequence, based on SEQRES records: (download)

>g1f0c.1 e.1.1.1 (A:,B:) Viral serpin crmA (cytokine response modifier protein) {Cowpox virus [TaxId: 10243]}
mdifreiassmkgenvfisppsissvltilyygangstaeqlskyvekeadknkddisfk
smnkvygrysavfkdsflrkigdnfqtvdftdcrtvdainkcvdiftegkinplldepls
pdtcllaisavyfkakwlmpfekeftsdypfyvsptemvdvsmmsmygeafnhasvkesf
gnfsiielpyvgdtsmvvilpdnidglesieqnltdtnfkkwcdsmdamfidvhipkfkv
tgsynlvdalvklgltevfgstgdysnmcnsdvsvdamihktyidvneeyteaaaatcal
vadcaXstvtnefcadhpfiyvirhvdgkilfvgrycspttn

Sequence, based on observed residues (ATOM records): (download)

>g1f0c.1 e.1.1.1 (A:,B:) Viral serpin crmA (cytokine response modifier protein) {Cowpox virus [TaxId: 10243]}
mdifreiassmkgenvfisppsissvltilyygangstaeqlskyvedisfksmnkvygr
ysavfkdsflrkigdnfqtvdftdcrtvdainkcvdiftegkinplldeplspdtcllai
savyfkakwlmpfekeftsdypfyvsptemvdvsmmsmygeafnhasvkesfgnfsiiel
pyvgdtsmvvilpdnidglesieqnltdtnfkkwcdsmdamfidvhipkfkvtgsynlvd
alvklgltevfgstgdysnmcnsdvsvdamihktyidvneeyteaaaatcalvadcaXst
vtnefcadhpfiyvirhvdgkilfvgrycspttn

SCOPe Domain Coordinates for d1f0c.1:

Click to download the PDB-style file with coordinates for d1f0c.1.
(The format of our PDB-style files is described here.)

Timeline for d1f0c.1: