Lineage for d1sek__ (1sek -)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86314Fold e.1: Serpins [56573] (1 superfamily)
  4. 86315Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 86316Family e.1.1.1: Serpins [56575] (11 proteins)
  6. 86399Protein Serpin K [56591] (1 species)
  7. 86400Species Tobacco hawkmoth (Manduca sexta) [TaxId:7130] [56592] (1 PDB entry)
  8. 86401Domain d1sek__: 1sek - [42675]

Details for d1sek__

PDB Entry: 1sek (more details), 2.1 Å

PDB Description: the structure of active serpin k from manduca sexta and a model for serpin-protease complex formation

SCOP Domain Sequences for d1sek__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sek__ e.1.1.1 (-) Serpin K {Tobacco hawkmoth (Manduca sexta)}
getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfnk
ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
gitaleqklkdpkalsraeerlynteveiylpkfkietttdlkevlsnmnikklftpgaa
rlenllktkeslyvdaaiqkafievneegaeaaaanafkittysfhfvpkveinkpfffs
lkynrnsmfsgvcvqp

SCOP Domain Coordinates for d1sek__:

Click to download the PDB-style file with coordinates for d1sek__.
(The format of our PDB-style files is described here.)

Timeline for d1sek__: