Lineage for d1b3kc_ (1b3k C:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37755Fold e.1: Serpins [56573] (1 superfamily)
  4. 37756Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 37757Family e.1.1.1: Serpins [56575] (9 proteins)
  6. 37811Protein Plasminogen activator inhibitor-1 [56587] (1 species)
  7. 37812Species Human (Homo sapiens) [TaxId:9606] [56588] (7 PDB entries)
  8. 37823Domain d1b3kc_: 1b3k C: [42670]

Details for d1b3kc_

PDB Entry: 1b3k (more details), 2.99 Å

PDB Description: plasminogen activator inhibitor-1

SCOP Domain Sequences for d1b3kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3kc_ e.1.1.1 (C:) Plasminogen activator inhibitor-1 {Human (Homo sapiens)}
yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
tgtvlfmgqvmep

SCOP Domain Coordinates for d1b3kc_:

Click to download the PDB-style file with coordinates for d1b3kc_.
(The format of our PDB-style files is described here.)

Timeline for d1b3kc_: