Lineage for d1b3kb_ (1b3k B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56588] (21 PDB entries)
  8. Domain d1b3kb_: 1b3k B: [42669]

Details for d1b3kb_

PDB Entry: 1b3k (more details), 2.9899999999999998 Å

PDB Description: plasminogen activator inhibitor-1
PDB Compounds: (B:) plasminogen activator inhibitor-1

SCOPe Domain Sequences for d1b3kb_:

Sequence, based on SEQRES records: (download)

>d1b3kb_ e.1.1.1 (B:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
tgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d1b3kb_ e.1.1.1 (B:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
tslsdqeplhvalalqkvkievnesgapeeiiidrpflfvvrhnptgtvlfmgqvmep

SCOPe Domain Coordinates for d1b3kb_ are not available.

Timeline for d1b3kb_:

Domains from other chains:
(mouse over for more information)
d1b3ka_, d1b3kc_, d1b3kd_