Lineage for d9paia_ (9pai A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568293Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. 2568294Species Human (Homo sapiens) [TaxId:9606] [56588] (16 PDB entries)
  8. 2568318Domain d9paia_: 9pai A: [42667]

Details for d9paia_

PDB Entry: 9pai (more details), 2.7 Å

PDB Description: cleaved substrate variant of plasminogen activator inhibitor-1
PDB Compounds: (A:) PROTEIN (PLASMINOGEN ACTIVATOR INHIBITOR-1) residues 19-364

SCOPe Domain Sequences for d9paia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d9paia_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfp
dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
qfqadftslsdqeplhvaqalqkvkievnesgtvpssstavivsar

SCOPe Domain Coordinates for d9paia_:

Click to download the PDB-style file with coordinates for d9paia_.
(The format of our PDB-style files is described here.)

Timeline for d9paia_: