Lineage for d1dvmd_ (1dvm D:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86314Fold e.1: Serpins [56573] (1 superfamily)
  4. 86315Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 86316Family e.1.1.1: Serpins [56575] (11 proteins)
  6. 86376Protein Plasminogen activator inhibitor-1 [56587] (1 species)
  7. 86377Species Human (Homo sapiens) [TaxId:9606] [56588] (7 PDB entries)
  8. 86384Domain d1dvmd_: 1dvm D: [42666]

Details for d1dvmd_

PDB Entry: 1dvm (more details), 2.4 Å

PDB Description: active form of human pai-1

SCOP Domain Sequences for d1dvmd_:

Sequence, based on SEQRES records: (download)

>d1dvmd_ e.1.1.1 (D:) Plasminogen activator inhibitor-1 {Human (Homo sapiens)}
ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
adftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvr
hnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d1dvmd_ e.1.1.1 (D:) Plasminogen activator inhibitor-1 {Human (Homo sapiens)}
ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
adftslsdqeplhvalalqkvkievnesgtstavivsarmapeeiiidrpflfvvrhnpt
gtvlfmgqvmep

SCOP Domain Coordinates for d1dvmd_:

Click to download the PDB-style file with coordinates for d1dvmd_.
(The format of our PDB-style files is described here.)

Timeline for d1dvmd_: