Lineage for d1dvmd_ (1dvm D:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012400Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 3012401Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 3012402Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 3012519Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. 3012520Species Human (Homo sapiens) [TaxId:9606] [56588] (21 PDB entries)
  8. 3012546Domain d1dvmd_: 1dvm D: [42666]
    complexed with cl

Details for d1dvmd_

PDB Entry: 1dvm (more details), 2.4 Å

PDB Description: active form of human pai-1
PDB Compounds: (D:) plasminogen activator inhibitor-1

SCOPe Domain Sequences for d1dvmd_:

Sequence, based on SEQRES records: (download)

>d1dvmd_ e.1.1.1 (D:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
adftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvr
hnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d1dvmd_ e.1.1.1 (D:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
adftslsdqeplhvalalqkvkievnesgtstavivsarmapeeiiidrpflfvvrhnpt
gtvlfmgqvmep

SCOPe Domain Coordinates for d1dvmd_:

Click to download the PDB-style file with coordinates for d1dvmd_.
(The format of our PDB-style files is described here.)

Timeline for d1dvmd_: