Lineage for d1dvmb_ (1dvm B:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140365Fold e.1: Serpins [56573] (1 superfamily)
  4. 140366Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 140367Family e.1.1.1: Serpins [56575] (12 proteins)
  6. 140431Protein Plasminogen activator inhibitor-1 [56587] (1 species)
  7. 140432Species Human (Homo sapiens) [TaxId:9606] [56588] (7 PDB entries)
  8. 140437Domain d1dvmb_: 1dvm B: [42664]

Details for d1dvmb_

PDB Entry: 1dvm (more details), 2.4 Å

PDB Description: active form of human pai-1

SCOP Domain Sequences for d1dvmb_:

Sequence, based on SEQRES records: (download)

>d1dvmb_ e.1.1.1 (B:) Plasminogen activator inhibitor-1 {Human (Homo sapiens)}
ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
adftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvr
hnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d1dvmb_ e.1.1.1 (B:) Plasminogen activator inhibitor-1 {Human (Homo sapiens)}
ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
adftslsdqeplhvalalqkvkievnesgtvamapeeiiidrpflfvvrhnptgtvlfmg
qvmep

SCOP Domain Coordinates for d1dvmb_:

Click to download the PDB-style file with coordinates for d1dvmb_.
(The format of our PDB-style files is described here.)

Timeline for d1dvmb_: