Lineage for d1a7ca_ (1a7c A:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37755Fold e.1: Serpins [56573] (1 superfamily)
  4. 37756Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 37757Family e.1.1.1: Serpins [56575] (9 proteins)
  6. 37811Protein Plasminogen activator inhibitor-1 [56587] (1 species)
  7. 37812Species Human (Homo sapiens) [TaxId:9606] [56588] (7 PDB entries)
  8. 37813Domain d1a7ca_: 1a7c A: [42660]

Details for d1a7ca_

PDB Entry: 1a7c (more details), 1.95 Å

PDB Description: human plasminogen activator inhibitor type-1 in complex with a pentapeptide

SCOP Domain Sequences for d1a7ca_:

Sequence, based on SEQRES records: (download)

>d1a7ca_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens)}
hhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaa
mgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstv
kqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfpd
ssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapy
ekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrq
fqadftslsdqeplhvaqalqkvkievnesgtvessstavivsarmapeeiimdrpflfv
vrhnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d1a7ca_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens)}
hhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaa
mgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstv
kqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfpd
ssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapy
ekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrq
fqadftslsdqeplhvaqalqkvkievnesgtapeeiimdrpflfvvrhnptgtvlfmgq
vmep

SCOP Domain Coordinates for d1a7ca_:

Click to download the PDB-style file with coordinates for d1a7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1a7ca_: