Lineage for d1a7ca_ (1a7c A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568293Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. 2568294Species Human (Homo sapiens) [TaxId:9606] [56588] (16 PDB entries)
  8. 2568296Domain d1a7ca_: 1a7c A: [42660]
    complexed with nag

Details for d1a7ca_

PDB Entry: 1a7c (more details), 1.95 Å

PDB Description: human plasminogen activator inhibitor type-1 in complex with a pentapeptide
PDB Compounds: (A:) plasminogen activator inhibitor type 1

SCOPe Domain Sequences for d1a7ca_:

Sequence, based on SEQRES records: (download)

>d1a7ca_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
hhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaa
mgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstv
kqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfpd
ssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapy
ekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrq
fqadftslsdqeplhvaqalqkvkievnesgtvessstavivsarmapeeiimdrpflfv
vrhnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d1a7ca_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
hhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaa
mgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstv
kqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfpd
ssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapy
ekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrq
fqadftslsdqeplhvaqalqkvkievnesgtapeeiimdrpflfvvrhnptgtvlfmgq
vmep

SCOPe Domain Coordinates for d1a7ca_:

Click to download the PDB-style file with coordinates for d1a7ca_.
(The format of our PDB-style files is described here.)

Timeline for d1a7ca_: