Lineage for d1atta_ (1att A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568188Protein Antithrombin [56584] (2 species)
  7. 2568189Species Cow (Bos taurus) [TaxId:9913] [56585] (1 PDB entry)
  8. 2568190Domain d1atta_: 1att A: [42638]

Details for d1atta_

PDB Entry: 1att (more details), 3.2 Å

PDB Description: crystal structure of cleaved bovine antithrombin iii at 3.2 angstroms resolution
PDB Compounds: (A:) antithrombin III

SCOPe Domain Sequences for d1atta_:

Sequence, based on SEQRES records: (download)

>d1atta_ e.1.1.1 (A:) Antithrombin {Cow (Bos taurus) [TaxId: 9913]}
vedvctakprdipvnpmciyrssekkategqgseqkipgatnrrvwelskanshfatafy
qhladsknnndniflsplsistafamtklgacnntltqlmevfkfdtisektsdqihfff
aklncrlyrkanksselvsanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsr
ltinqwisnktegritdvippqaineftvlvlvntiyfkglwkskfspentrkelfykad
gescsvlmmyqeskfryrrvaestqvlelpfkgdditmvlilpklektlakveqeltpdm
lqewldeltetllvvhmprfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdly
vsdafhkaflevneegseaaastvisiagrslnsdrvtfkanrpflvlirevalntiifm
grvanpcvd

Sequence, based on observed residues (ATOM records): (download)

>d1atta_ e.1.1.1 (A:) Antithrombin {Cow (Bos taurus) [TaxId: 9913]}
vedvctakprdipvnpmciyrategqgseqkipgatnrrvwelskanshfatafyqhlad
sknnndniflsplsistafamtklgacnntltqlmevfkfdtisektsdqihfffaklnc
rlyrkanksselvsanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsrltinq
wisnktegritdvippqaineftvlvlvntiyfkglwkskfspentrkelfykadgescs
vlmmyqeskfryrrvaestqvlelpfkgdditmvlilpklektlakveqeltpdmlqewl
deltetllvvhmprfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdlyvsdaf
hkaflevneegseaaastvisiagrslrvtfkanrpflvlirevalntiifmgrvanpcv
d

SCOPe Domain Coordinates for d1atta_:

Click to download the PDB-style file with coordinates for d1atta_.
(The format of our PDB-style files is described here.)

Timeline for d1atta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1attb_