Lineage for d1qmb.1 (1qmb A:,B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568244Protein Antitrypsin, alpha-1 [56582] (1 species)
  7. 2568245Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries)
  8. 2568251Domain d1qmb.1: 1qmb A:,B: [42633]

Details for d1qmb.1

PDB Entry: 1qmb (more details), 2.6 Å

PDB Description: cleaved alpha-1-antitrypsin polymer
PDB Compounds: (A:) alpha-1-antitrypsin, (B:) alpha-1-antitrypsin

SCOPe Domain Sequences for d1qmb.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qmb.1 e.1.1.1 (A:,B:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
kitpnlaefafslyrqlahqsstniffspvsiatafamlslgtkadthdeileglnfnlt
eipeaaihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftv
nfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdtee
edfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlen
elthdiitkflendrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeap
lklskavhkavltidekgteaagamfXleaiprsippevkfnapfvflmieqntksplfm
gkvvnptqk

SCOPe Domain Coordinates for d1qmb.1:

Click to download the PDB-style file with coordinates for d1qmb.1.
(The format of our PDB-style files is described here.)

Timeline for d1qmb.1: