SCOP 1.73: Domain d9api.1: 9api A:,B:

Lineage for d9api.1 (9api A:,B:)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.1: Serpins [56573] (1 superfamily)
   contains a cluster of helices and a beta-sandwich

4. Superfamily e.1.1: Serpins [56574] (1 family)

5. Family e.1.1.1: Serpins [56575] (16 proteins)

6. Protein Antitrypsin, alpha-1 [56582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56583] (14 PDB entries)

8. Domain d9api.1: 9api A:,B: [42630]
   complexed with man, nag

Details for d9api.1

PDB Entry: 9api, 3 Å

PDB Description: the s variant of human alpha1-antitrypsin, structure and implications for function and metabolism

PDB Compounds: (A:) alpha 1-antitrypsin, (B:) alpha 1-antitrypsin

SCOP Domain Sequences for d9api.1:

Sequence; same for both SEQRES and ATOM records:

>g9api.1 e.1.1.1 (A:,B:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
hptfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileg
lnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyh
seaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfe
vkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegk
lqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadls
gvteeaplklskavhkavltidekgteaagamfleaipmXsippevkfnkpfvflmieqn
tksplfmgkvvnptqk

Timeline for d9api.1:

• d9api.1 first appeared (with stable ids) in SCOP 1.55
  
• d9api.1 appears in SCOP 1.71
  
• d9api.1 appears in SCOP 1.75
  
• d9api.1 appears in the current release, SCOPe 2.08