Lineage for d2ach.1 (2ach A:,B:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) 
Fold e.1: Serpins [56573] (1 superfamily) Superfamily e.1.1: Serpins [56574] (1 family) 
Family e.1.1.1: Serpins [56575] (9 proteins) 
Protein Antichymotrypsin, alpha-1 [56580] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56581] (5 PDB entries) 
Domain d2ach.1: 2ach A:,B: [42626]
Details for d2ach.1
PDB Entry: 2ach (more details), 2.7 Å
PDB Description: crystal structure of cleaved human alpha1-antichymotrypsin at 2.7 angstroms resolution and its comparison with other serpins
SCOP Domain Sequences for d2ach.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g2ach.1 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human (Homo sapiens)}
lglasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfn
ltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseaf
atdfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdt
hqsrfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmee
veamllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgi
tgarnlavsqvvhkavldvfeegteasaatavkitllXtrtivrfnrpflmiivptdtqn
iffmskvtnpkqa
SCOP Domain Coordinates for d2ach.1:
Click to download the PDB-style file with coordinates for d2ach.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ach.1:
- d2ach.1 appears in SCOP 1.57
- d2ach.1 appears in the current release, SCOPe 2.08
View in 3D