Lineage for d2ach.1 (2ach A:,B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012400Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 3012401Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 3012402Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 3012407Protein Antichymotrypsin, alpha-1 [56580] (1 species)
  7. 3012408Species Human (Homo sapiens) [TaxId:9606] [56581] (5 PDB entries)
  8. 3012413Domain d2ach.1: 2ach A:,B: [42626]
    complexed with po4

Details for d2ach.1

PDB Entry: 2ach (more details), 2.7 Å

PDB Description: crystal structure of cleaved human alpha1-antichymotrypsin at 2.7 angstroms resolution and its comparison with other serpins
PDB Compounds: (A:) alpha 1-antichymotrypsin, (B:) alpha 1-antichymotrypsin

SCOPe Domain Sequences for d2ach.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2ach.1 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
lglasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfn
ltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseaf
atdfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdt
hqsrfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmee
veamllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgi
tgarnlavsqvvhkavldvfeegteasaatavkitllXtrtivrfnrpflmiivptdtqn
iffmskvtnpkqa

SCOPe Domain Coordinates for d2ach.1:

Click to download the PDB-style file with coordinates for d2ach.1.
(The format of our PDB-style files is described here.)

Timeline for d2ach.1: