Lineage for d3caa.1 (3caa A:,B:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37755Fold e.1: Serpins [56573] (1 superfamily)
  4. 37756Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 37757Family e.1.1.1: Serpins [56575] (9 proteins)
  6. 37758Protein Antichymotrypsin, alpha-1 [56580] (1 species)
  7. 37759Species Human (Homo sapiens) [TaxId:9606] [56581] (5 PDB entries)
  8. 37762Domain d3caa.1: 3caa A:,B: [42625]

Details for d3caa.1

PDB Entry: 3caa (more details), 2.4 Å

PDB Description: cleaved antichymotrypsin a347r

SCOP Domain Sequences for d3caa.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g3caa.1 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human (Homo sapiens)}
asanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfnlte
tseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafatd
fqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdthqs
rfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeevea
mllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitga
rnlavsqvvhkavldvfeegtersaatavkitllXrtivrfnrpflmiivptdtqniffm
skvtnpk

SCOP Domain Coordinates for d3caa.1:

Click to download the PDB-style file with coordinates for d3caa.1.
(The format of our PDB-style files is described here.)

Timeline for d3caa.1: