Lineage for d1qmna_ (1qmn A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2243858Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2243859Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2243860Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2243865Protein Antichymotrypsin, alpha-1 [56580] (1 species)
  7. 2243866Species Human (Homo sapiens) [TaxId:9606] [56581] (5 PDB entries)
  8. 2243868Domain d1qmna_: 1qmn A: [42624]
    intact, in the delta conformation (partial loop insertion)

Details for d1qmna_

PDB Entry: 1qmn (more details), 2.27 Å

PDB Description: alpha1-antichymotrypsin serpin in the delta conformation (partial loop insertion)
PDB Compounds: (A:) alpha-1-antichymotrypsin

SCOPe Domain Sequences for d1qmna_:

Sequence, based on SEQRES records: (download)

>d1qmna_ e.1.1.1 (A:) Antichymotrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
lasanvdfafslykqlvlkapdknvifsppsistalaflslgahnttlteilkglkfnlt
etseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafat
dfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdthq
srfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeeve
amllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitg
arnlavsqvvhkavldvfeegteasaatavkitllsalvetrtivrfnrpflmiivptdt
qniffmskvtnpkq

Sequence, based on observed residues (ATOM records): (download)

>d1qmna_ e.1.1.1 (A:) Antichymotrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
lasanvdfafslykqlvlkapdknvifsppsistalaflslgahnttlteilkglkfnlt
etseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafat
dfqdsaaakklindyvkngtrgkitdlisqtmmvlvnyiffkakwempfdpqdthqsrfy
lskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeeveamll
petlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitgarnl
avsqvvhkavldvfeegteasaatalsalvetrtivrfnrpflmiivptdtqniffmskv
tnpkq

SCOPe Domain Coordinates for d1qmna_:

Click to download the PDB-style file with coordinates for d1qmna_.
(The format of our PDB-style files is described here.)

Timeline for d1qmna_: