Lineage for d1as4.1 (1as4 A:,B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568181Protein Antichymotrypsin, alpha-1 [56580] (1 species)
  7. 2568182Species Human (Homo sapiens) [TaxId:9606] [56581] (5 PDB entries)
  8. 2568183Domain d1as4.1: 1as4 A:,B: [42623]
    complexed with act

Details for d1as4.1

PDB Entry: 1as4 (more details), 2.1 Å

PDB Description: cleaved antichymotrypsin a349r
PDB Compounds: (A:) antichymotrypsin, (B:) antichymotrypsin

SCOPe Domain Sequences for d1as4.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1as4.1 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
glasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfnl
tetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafa
tdfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdth
qsrfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeev
eamllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgit
garnlavsqvvhkavldvfeegteasratavkitllXgtivrfnrpflmiivptdtqnif
fmskvtnpkq

SCOPe Domain Coordinates for d1as4.1:

Click to download the PDB-style file with coordinates for d1as4.1.
(The format of our PDB-style files is described here.)

Timeline for d1as4.1: