Lineage for d1hle.1 (1hle A:,B:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37755Fold e.1: Serpins [56573] (1 superfamily)
  4. 37756Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 37757Family e.1.1.1: Serpins [56575] (9 proteins)
  6. 37802Protein Elastase inhibitor [56576] (1 species)
  7. 37803Species Horse (Equus caballus) [TaxId:9796] [56577] (1 PDB entry)
  8. 37804Domain d1hle.1: 1hle A:,B: [42618]

Details for d1hle.1

PDB Entry: 1hle (more details), 1.95 Å

PDB Description: crystal structure of cleaved equine leucocyte elastase inhibitor determined at 1.95 angstroms resolution

SCOP Domain Sequences for d1hle.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1hle.1 e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus caballus)}
meqlstanthfavdlfralnesdptgnifisplsissalamiflgtrgntaaqvskalyf
dtvedihsrfqslnadinkpgapyilklanrlygektynfladflastqkmygaelasvd
fqqapedarkeinewvkgqtegkipellvkgmvdnmtklvlvnaiyfkgnwqqkfmkeat
rdapfrlnkkdtktvkmmyqkkkfpynyiedlkcrvlelpyqgkelsmiillpddiedes
tglekiekqltldklrewtkpenlylaevnvhlprfkleesydltshlarlgvqdlfnrg
kadlsgmsgardlfvskiihksfvdlneegteaaaatagtillaXeenfnadhpfiffir
hnpsanilflgrfssp

SCOP Domain Coordinates for d1hle.1:

Click to download the PDB-style file with coordinates for d1hle.1.
(The format of our PDB-style files is described here.)

Timeline for d1hle.1: