Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) not a true superfamily |
Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein) consists of a long beta-hairpin and a single alpha-helix |
Protein Phycoerythrin 545 alpha-subunits [56570] (1 species) |
Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [56571] (3 PDB entries) Uniprot P30943 38-104 ! Uniprot Q00433 53-128 |
Domain d1qgwb_: 1qgw B: [42617] Other proteins in same PDB: d1qgwc_, d1qgwd_ complexed with cl, dbv, mg, peb |
PDB Entry: 1qgw (more details), 1.63 Å
SCOPe Domain Sequences for d1qgwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgwb_ d.184.1.1 (B:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]} amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat slakmtk
Timeline for d1qgwb_: