![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
![]() | Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) ![]() not a true superfamily |
![]() | Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein) consists of a long beta-hairpin and a single alpha-helix |
![]() | Protein Phycoerythrin 545 alpha-subunits [56570] (1 species) |
![]() | Species Cryptophyte (Rhodomonas sp.), cs24 [56571] (1 PDB entry) |
![]() | Domain d1qgwb_: 1qgw B: [42617] Other proteins in same PDB: d1qgwc_, d1qgwd_ complexed with cl, dbv, mo6, peb |
PDB Entry: 1qgw (more details), 1.63 Å
SCOP Domain Sequences for d1qgwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgwb_ d.184.1.1 (B:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp.), cs24} amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat slakmtk
Timeline for d1qgwb_: