Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.184: Non-globular alpha beta subunits of globular proteins [56567] (1 superfamily) |
Superfamily d.184.1: Non-globular alpha beta subunits of globular proteins [56568] (1 family) |
Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein) |
Protein Phycoerythrin 545 alpha-subunits [56570] (1 species) |
Species Cryptophyte (Rhodomonas sp.), cs24 [56571] (1 PDB entry) |
Domain d1qgwb_: 1qgw B: [42617] Other proteins in same PDB: d1qgwc_, d1qgwd_ |
PDB Entry: 1qgw (more details), 1.63 Å
SCOP Domain Sequences for d1qgwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgwb_ d.184.1.1 (B:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp.), cs24} amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat slakmtk
Timeline for d1qgwb_: