Lineage for d1el6a_ (1el6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005062Fold d.182: Baseplate structural protein gp11 [56557] (1 superfamily)
    unusual fold; trimer
  4. 3005063Superfamily d.182.1: Baseplate structural protein gp11 [56558] (1 family) (S)
    automatically mapped to Pfam PF08677
  5. 3005064Family d.182.1.1: Baseplate structural protein gp11 [56559] (1 protein)
  6. 3005065Protein Baseplate structural protein gp11 [56560] (1 species)
  7. 3005066Species Bacteriophage T4 [TaxId:10665] [56561] (1 PDB entry)
  8. 3005067Domain d1el6a_: 1el6 A: [42606]

Details for d1el6a_

PDB Entry: 1el6 (more details), 2 Å

PDB Description: structure of bacteriophage t4 gene product 11, the interface between the baseplate and short tail fibers
PDB Compounds: (A:) baseplate structural protein gp11

SCOPe Domain Sequences for d1el6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el6a_ d.182.1.1 (A:) Baseplate structural protein gp11 {Bacteriophage T4 [TaxId: 10665]}
srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
twnllgaqtvtldnqqtptvfyhferta

SCOPe Domain Coordinates for d1el6a_:

Click to download the PDB-style file with coordinates for d1el6a_.
(The format of our PDB-style files is described here.)

Timeline for d1el6a_: