Lineage for d1bdfd2 (1bdf D:53-178)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1444704Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1444705Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1444706Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1444707Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1444708Species Escherichia coli [TaxId:562] [56556] (1 PDB entry)
  8. 1444712Domain d1bdfd2: 1bdf D:53-178 [42605]
    Other proteins in same PDB: d1bdfa1, d1bdfb1, d1bdfc1, d1bdfd1

Details for d1bdfd2

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain
PDB Compounds: (D:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1bdfd2:

Sequence, based on SEQRES records: (download)

>d1bdfd2 d.181.1.1 (D:53-178) RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
gcavteveidgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvta
adithdgdveivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrll
vdacys

Sequence, based on observed residues (ATOM records): (download)

>d1bdfd2 d.181.1.1 (D:53-178) RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
gcavteveidgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvta
adithdgdveivkpqhvichltdenasismrikvqrgrgyvpastriherpigrllvdac
ys

SCOPe Domain Coordinates for d1bdfd2:

Click to download the PDB-style file with coordinates for d1bdfd2.
(The format of our PDB-style files is described here.)

Timeline for d1bdfd2: