Lineage for d1bdfa2 (1bdf A:53-178)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615331Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 615332Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 615333Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 615334Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 615335Species Escherichia coli [TaxId:562] [56556] (1 PDB entry)
  8. 615336Domain d1bdfa2: 1bdf A:53-178 [42602]
    Other proteins in same PDB: d1bdfa1, d1bdfb1, d1bdfc1, d1bdfd1

Details for d1bdfa2

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain

SCOP Domain Sequences for d1bdfa2:

Sequence, based on SEQRES records: (download)

>d1bdfa2 d.181.1.1 (A:53-178) RNA polymerase alpha subunit {Escherichia coli}
gcavteveidgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvta
adithdgdveivkpqhvichltdenasismrikvqrgrgyvpastrihseederpigrll
vdacys

Sequence, based on observed residues (ATOM records): (download)

>d1bdfa2 d.181.1.1 (A:53-178) RNA polymerase alpha subunit {Escherichia coli}
gcavteveidgvlheystkegvqedileillnlkglavrvqgkdeviltlnksgigpvta
adithdgdveivkpqhvichltdenasismrikvqrgrgyvpastrierpigrllvdacy
s

SCOP Domain Coordinates for d1bdfa2:

Click to download the PDB-style file with coordinates for d1bdfa2.
(The format of our PDB-style files is described here.)

Timeline for d1bdfa2: