Lineage for d16vpa_ (16vp A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561804Fold d.180: Conserved core of transcriptional regulatory protein vp16 [56547] (1 superfamily)
    unusual fold
  4. 2561805Superfamily d.180.1: Conserved core of transcriptional regulatory protein vp16 [56548] (1 family) (S)
    automatically mapped to Pfam PF02232
  5. 2561806Family d.180.1.1: Conserved core of transcriptional regulatory protein vp16 [56549] (1 protein)
  6. 2561807Protein Conserved core of transcriptional regulatory protein vp16 [56550] (1 species)
  7. 2561808Species Herpes simplex virus type 1 [TaxId:10298] [56551] (1 PDB entry)
  8. 2561809Domain d16vpa_: 16vp A: [42601]
    complexed with so4

Details for d16vpa_

PDB Entry: 16vp (more details), 2.1 Å

PDB Description: conserved core of the herpes simplex virus transcriptional regulatory protein vp16
PDB Compounds: (A:) protein (vp16, vmw65, atif)

SCOPe Domain Sequences for d16vpa_:

Sequence, based on SEQRES records: (download)

>d16vpa_ d.180.1.1 (A:) Conserved core of transcriptional regulatory protein vp16 {Herpes simplex virus type 1 [TaxId: 10298]}
srmpsppmpvppaalfnrllddlgfsagpalctmldtwnedlfsalptnadlyreckfls
tlpsdvvewgdayvpertqidirahgdvafptlpatrdglglyyealsrffhaelraree
syrtvlanfcsalyrylrasvrqlhrqahmrgrdrdlgemlratiadryyretarlarvl
flhlylfltreilwaayaeqmmrpdlfdclccdleswrqlaglfqpfmfvngaltvrgvp
iearrlrelnhirehlnlplvrsaateepgaplttpptlhgnqarasgyfmvliraklds
yssfttspseavmrehaysraptknnygstieglldlpdddapeeaglaaprlsfl

Sequence, based on observed residues (ATOM records): (download)

>d16vpa_ d.180.1.1 (A:) Conserved core of transcriptional regulatory protein vp16 {Herpes simplex virus type 1 [TaxId: 10298]}
srmpsppmpvppaalfnrllddlgfsagpalctmldtwnedlfsalptnadlyreckfls
tlpsdvvewgdayvpertqidirahgdvafptlpatrdglglyyealsrffhaelraree
syrtvlanfcsalyrylrasvrqlhrqahmrgrdrdlgemlratiadryyretarlarvl
flhlylfltreilwaayaeqmmrpdlfdclccdleswrqlaglfqpfmfvngaltvrgvp
iearrlrelnhirehlnlplvrsaateepgaplttpptlhgnqarasgyfmvliraklds
yssaaprlsfl

SCOPe Domain Coordinates for d16vpa_:

Click to download the PDB-style file with coordinates for d16vpa_.
(The format of our PDB-style files is described here.)

Timeline for d16vpa_: