Lineage for d1qayb2 (1qay B:504-610,B:721-877)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879178Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 879179Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 879180Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 879181Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 879219Species Pseudomonas mevalonii [TaxId:32044] [56546] (5 PDB entries)
    Uniprot P13702 4-377
  8. 879227Domain d1qayb2: 1qay B:504-610,B:721-877 [42600]
    Other proteins in same PDB: d1qaya1, d1qayb1
    complexed with mev, nad

Details for d1qayb2

PDB Entry: 1qay (more details), 2.8 Å

PDB Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with mevalonate and nad+
PDB Compounds: (B:) protein (3-hydroxy-3-methylglutaryl-coenzyme a reductase)

SCOP Domain Sequences for d1qayb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qayb2 d.179.1.1 (B:504-610,B:721-877) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritpq
qletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveagah
ayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqa
laeiavavglaqnlgamralategi

SCOP Domain Coordinates for d1qayb2:

Click to download the PDB-style file with coordinates for d1qayb2.
(The format of our PDB-style files is described here.)

Timeline for d1qayb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qayb1