SCOPe 2.01: Domain d1qaxb2: 1qax B:504-610,B:721-875

Lineage for d1qaxb2 (1qax B:504-610,B:721-875)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
   unusual fold

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Pseudomonas mevalonii [TaxId:32044] [56546] (5 PDB entries)
   Uniprot P13702 4-377

8. Domain d1qaxb2: 1qax B:504-610,B:721-875 [42598]
   Other proteins in same PDB: d1qaxa1, d1qaxb1
   complexed with hmg, nad

Details for d1qaxb2

PDB Entry: 1qax, 2.8 Å

PDB Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with hmg- coa and nad+

PDB Compounds: (B:) protein (3-hydroxy-3-methylglutaryl-coenzyme a reductase)

SCOPe Domain Sequences for d1qaxb2:

Sequence; same for both SEQRES and ATOM records:

>d1qaxb2 d.179.1.1 (B:504-610,B:721-875) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritpq
qletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveagah
ayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqa
laeiavavglaqnlgamralate

Timeline for d1qaxb2:

• d1qaxb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qaxb2 appears in SCOP 1.75
  
• d1qaxb2 appears in SCOPe 2.02
  
• d1qaxb2 appears in the current release, SCOPe 2.08